The
Artifact Index
← Atlas
Compare ↗
SCAR-003 · acquired 2025 · running time 149m
Ari Aster · 2025

Eddington

The bridge between a man and his neighbor is built of masks and lies.

Eddington is a National Nightmare crystallized into a neo-Western. Released in the summer of 2025, it serves as the definitive autopsy of the 2020 COVID-19 lockdowns and the ensuing social psychosis. Its mention density is characterized by high political volatility; it is a film that refuses to offer a safe side, mocking the performative ethics of the left and the macho-individualism of the right with equal vitriol. It has a high Residual Haunting score tied to its depiction of digital loneliness — the alien glow of the smartphone screen in a dark bedroom — and a climax that many have described as a Rambo-style explosion of repressed American rage.

CNSFRCOBSHNTSYMCLTFRMVLTACCRCHPRGARCTRX

The Reading

Lexicon ↗
Consensus
Present38

Contested — a dominant reading exists but is regularly challenged.

Friction
Extreme94

Contested — the work refuses every attempt at assimilation.

Near-ceiling. The film's refusal to provide a moral center has led to ongoing interpretive wars regarding Aster's own political nihilism.

Obsession
Extreme82

Consumed — being lived with over time, not filed away.

Residual Haunting
Extreme87

Installed — the work recurs without invitation; it has moved in.

Scores high for the Instagram-Scroll sequences, which viewers describe as an uncomfortably accurate intrusive memory of the lockdown era.

Symbolic Density
Extreme90

Dense — read as territory to map; multiple competing frameworks.

Dense with ciphers: 5G conspiracy imagery, the Marlboro Man archetype, and the literal cross of the protagonist's name (Joe Cross).

Cult Formation
Elevated68

Formed — a distinct custodial community exists and is active.

Formal Risk
Extreme84

Radical — the work refused every known shape and chose another.

Emotional Voltage
Extreme91

Extreme — the work moves bodies; crying, panic, awe, nausea in the record.

Accessibility
Elevated65

Open — most viewers can enter without special context.

Reach
Extreme78

Saturated — a shared reference in the general cultural vocabulary.

Progeny
Present42

Acknowledged — named as an influence by a handful of subsequent filmmakers.

Cultural Arc
Elevated55

Overturned — the work's cultural position is substantially different from its initial reception.

Transgression
Extreme88

Prohibited — banned, censored, or formally classified as socially harmful in one or more contexts.

The film's Rambo climax and its clinical depiction of domestic rot are cited as high-level provocations.

Cultural Afterlife

2025 → 2026
2025
2025 · release
Cannes premiere creates a Bleak Week phenomenon; theatrical release in July is met with polarizing fury.
2025 · wound
Social media discourse erupts over the film's Centrist Nihilism and its treatment of its only Black protagonist.
2025 · reissue
Debuts on HBO Max in November, sparking a second wave of Home-Invasion viewing anxiety.
2026 · academic
Becomes a cornerstone of Post-Pandemic Studies and the centerpiece of the 5th annual Bleak Week retrospective.
release / rediscovery / criterion
rejection / meme / wound
academic adoption

Discourse Factions

The Political Skeptics
45%

“It's a cruel, self-satisfied movie that mocks the very real suffering of 2020 without offering a shred of catharsis.”

The Aster Purists
40%

“Masterpiece. It's the only film that captures how truly insane we all were. It steps outside the debate to watch the world burn.”

The Visualists
15%

“Regardless of the plot, Khondji's cinematography is a miracle. That hill-run sequence is pure Hitchcockian adrenaline.”

Recurring Symbols

  • the blue surgical masksurfaced
  • the smartphone glowsurfaced
  • the copper minesurfaced
  • the 5G towersurfaced
  • the machine gunsurfaced

Adjacent Pressure