The
Artifact Index
← Atlas
Compare ↗
ARTX-099 · acquired 1981 · running time 124m
Andrzej Żuławski · 1981

Possession

I believe in only one thing: that the impossible is possible.

Andrzej Żuławski's volcanic, chamber-horror rupture stands as the supreme, unclassifiable specimen of European art-cinema operating at the absolute limit of its own formal collapse. Produced in divided Berlin with a savagery that bleeds through every celluloid frame, the film weaponizes marital disintegration into a full-body assault on the viewer's nervous system—specifically through Isabelle Adjani's historic, supernova performance, which culminates in the legendary subway sequence, a sustained act of physical performance so extreme that the footage exists outside conventional critical vocabulary. The film occupies a uniquely contradictory cultural position: a Video Nasty banned in the UK, a Cannes Best Actress winner in the same breath, a work of political allegory about Cold War division that simultaneously functions as a graphic horror film about a woman birthing a creature from her grief. Its fractured, deliberately incoherent narrative structure is not a failure of craft but a systematic formal enactment of the psychological dissolution at its center, producing an artifact that defies containment and generates perpetually unresolved interpretive combat.

CNSFRCOBSHNTSYMCLTFRMVLTACCRCHPRGARCTRX

The Reading

Lexicon ↗
Consensus
Elevated74

Settled — broad alignment with pockets of dissent.

Friction
Extreme96

Contested — the work refuses every attempt at assimilation.

One of the highest friction scores in the index. The deliberate narrative incoherence—the creature, the double, the Cold War allegory—generates active, irresolvable critical combat between those who read it as allegory and those who read it as pure horror.

Obsession
Extreme93

Consumed — being lived with over time, not filed away.

Residual Haunting
Extreme99

Installed — the work recurs without invitation; it has moved in.

Near-maximum. The subway sequence is a permanent, involuntary neurological imprint. Adjani's sustained physical performance in that scene—minutes of convulsive, hysterical grief—is the most extreme act of presence recorded in the European art-cinema tradition.

Symbolic Density
Extreme91

Dense — read as territory to map; multiple competing frameworks.

Cult Formation
Extreme87

Entrenched — deep devotion, often shaped by initial rejection and reclamation.

Formal Risk
Extreme96

Radical — the work refused every known shape and chose another.

Emotional Voltage
Extreme100

Extreme — the work moves bodies; crying, panic, awe, nausea in the record.

Maximum current. The film runs at a sustained physiological fever pitch from its opening minutes, never releasing the viewer from a state of acute somatic stress.

Accessibility
Present28

Selective — available to prepared viewers; rewards prior knowledge.

Extremely low. The film's deliberate narrative ruptures, the demands of its extreme performance register, and its refusal to provide any interpretive handrails make it a brutal, high-casualty entry point.

Reach
Elevated71

Permeating — imagery and language used by people who have not seen the work.

Progeny
Extreme82

Foundational — a genre, subgenre, or movement traces its origin here.

Cultural Arc
Extreme89

Transformed — near-complete reversal in standing since release.

Transgression
Extreme94

Prohibited — banned, censored, or formally classified as socially harmful in one or more contexts.

Cultural Afterlife

1981 → 2026
1981
1986
1991
1996
2001
2006
2011
2016
2021
2026
1981 · release
Isabelle Adjani wins Best Actress at Cannes while the film simultaneously circulates as a Video Nasty in the UK.
1983 · wound
A drastically re-edited, butchered American cut strips 40 minutes and destroys the film's structural logic, circulating under the title *The Night the Screaming Stops*.
1999 · rediscovery
A wave of arthouse retrospectives and restoration screenings begin the sustained critical reclamation project, separating the film from its exploitation-cinema reputation.
2010 · academic
Integrated into feminist film theory and trauma studies as a primary text on female hysteria, bodily autonomy, and the politics of cinematic abjection.
2023 · reissue
A new 4K restoration by Metrograph Pictures triggers a global theatrical revival and a comprehensive critical re-evaluation, elevating the film to canonical status.
release / rediscovery / criterion
rejection / meme / wound
academic adoption

Discourse Factions

The Body-Horror Absolutists
38%

It is the most physically overwhelming film ever made. The subway scene is not performance; it is a documented act of human dissolution that can never be unseen.

The Allegorical Readers
35%

The creature, the double, the divided city—it is a formally rigorous political film about Cold War Berlin that uses body horror as its grammar, not its subject.

The Feminist Theorists
27%

It is the most radically honest film about female rage, bodily autonomy, and the violence of heterosexual marriage ever committed to film, and Adjani's performance is its complete vindication.

Recurring Symbols

  • The Subway Corridorsurfaced
  • The Creature in the Apartmentsurfaced
  • Anna's Doublesurfaced
  • The Berlin Wallsurfaced
  • The Suitcase of Raw Meatsurfaced

Adjacent Pressure